Anti-SI Antibody Picoband®

SI Sucrase-Isomaltase antibody

Boster Bio Anti-SI Antibody Picoband® catalog # A04542-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A04542-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-SI Antibody Picoband®

View all SI Sucrase-Isomaltase Antibodies

SKU/Catalog Number

A04542-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SI Antibody Picoband® catalog # A04542-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SI Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04542-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human SI, which shares 86.1% amino acid (aa) sequence identity with rat SI.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A04542-1 is reactive to SI in Human, Mouse, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

209 kDa

Calculated molecular weight

209.453kDa

Background of SI Sucrase-Isomaltase

This gene is mapped to 3q26.1. It encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A04542-1 is guaranteed for IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml

Positive Control

WB: human Hela whole cell, human COLO-320 whole cell, human SHG-44 whole cell, human HEK293 whole cell, rat intestine tissue
IHC: mouse intestine tissue, rat intestine tissue, rat intestine tissue

Validation Images & Assay Conditions

Gene/Protein Information For SI (Source: Uniprot.org, NCBI)

Gene Name

SI

Full Name

Sucrase-isomaltase, intestinal

Weight

209.453kDa

Superfamily

glycosyl hydrolase 31 family

Alternative Names

Sucrase-isomaltase, intestinal; Sucrase; Isomaltase; SI SI sucrase-isomaltase sucrase-isomaltase, intestinal|Alpha-methylglucosidase|Oligo-1,6-glucosidase|alpha-glucosidase|oligosaccharide alpha-1,6-glucosidase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on SI, check out the SI Infographic

SI infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SI: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A04542-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SI Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-SI Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

13 Customer Q&As for Anti-SI Antibody Picoband®

Question

My question regarding product A04542-1, anti-SI antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-04-10

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04542-1 anti-SI antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-04-10

Question

I see that the anti-SI antibody A04542-1 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-03-24

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-03-24

Question

We are currently using anti-SI antibody A04542-1 for rat tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-08

Answer

The anti-SI antibody (A04542-1) has not been tested for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-08

Question

Does A04542-1 anti-SI antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-01-02

Answer

It shows on the product datasheet, A04542-1 anti-SI antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-01-02

Question

I was wanting to use to test anti-SI antibody A04542-1 on mouse jejunal mucosa for research purposes, then I may be interested in using anti-SI antibody A04542-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-11-13

Answer

The products we sell, including anti-SI antibody A04542-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-11-13

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for jejunal mucosa using anti-SI antibody A04542-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-11-08

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-08

Question

See attached the WB image, lot number and protocol we used for jejunal mucosa using anti-SI antibody A04542-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-04-12

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-04-12

Question

Is a blocking peptide available for product anti-SI antibody (A04542-1)?

Verified Customer

Verified customer

Asked: 2018-12-18

Answer

We do provide the blocking peptide for product anti-SI antibody (A04542-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-12-18

Question

I was wanting to use your anti-SI antibody for IHC for mouse jejunal mucosa on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse jejunal mucosa identification?

Verified Customer

Verified customer

Asked: 2018-08-28

Answer

You can see on the product datasheet, A04542-1 anti-SI antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse jejunal mucosa in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-08-28

Question

Does anti-SI antibody A04542-1 work on feline IHC with intestine?

F. Krishna

Verified customer

Asked: 2015-07-30

Answer

Our lab technicians have not validated anti-SI antibody A04542-1 on feline. You can run a BLAST between feline and the immunogen sequence of anti-SI antibody A04542-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline intestine in IHC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2015-07-30

Question

Is this A04542-1 anti-SI antibody reactive to the isotypes of SI?

C. Taylor

Verified customer

Asked: 2014-11-28

Answer

The immunogen of A04542-1 anti-SI antibody is A synthetic peptide corresponding to a sequence of human SI (FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-11-28

Question

Does anti-SI antibody A04542-1 work for IHC with jejunal mucosa?

K. Huang

Verified customer

Asked: 2014-11-14

Answer

According to the expression profile of jejunal mucosa, SI is highly expressed in jejunal mucosa. So, it is likely that anti-SI antibody A04542-1 will work for IHC with jejunal mucosa.

Boster Scientific Support

Answered: 2014-11-14

Question

Do you have a BSA free version of anti-SI antibody A04542-1 available?

S. Collins

Verified customer

Asked: 2013-03-06

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-SI antibody A04542-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2013-03-06

Order DetailsPrice
A04542-1

100μg

$370
A04542-1-10ug

10μg sample (liquid)

$99
A04542-1-Biotin

100 μg Biotin conjugated

$570
A04542-1-Cy3

100 μg Cy3 conjugated

$570
A04542-1-Dylight488

100 μg Dylight488 conjugated

$570
A04542-1-Dylight550

100 μg Dylight550 conjugated

$570
A04542-1-Dylight594

100 μg Dylight594 conjugated

$570
A04542-1-FITC

100 μg FITC conjugated

$570
A04542-1-HRP

100 μg HRP conjugated

$570
A04542-1-APC

100 μg APC conjugated

$670
A04542-1-PE

100 μg PE conjugated

$670
A04542-1-iFluor647

100 μg iFluor647 conjugated

$670
A04542-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A04542-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product