Click image to see more details
Product Info Summary
| SKU: | A01025-Dyl550 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human |
| Host: | Rabbit |
| Application: | Flow Cytometry |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Human DC-SIGN DyLight® 550 conjugated CD209 Antibody
SKU/Catalog Number
A01025-Dyl550
Size
100 μg/vial
Form
Liquid
Description
Boster Bio Anti-Human DC-SIGN DyLight® 550 conjugated CD209 Antibody catalog # A01025-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Storage & Handling
At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.
Cite This Product
Anti-Human DC-SIGN DyLight® 550 conjugated CD209 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01025-Dyl550)
Host
Rabbit
Contents
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human DC-SIGN.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01025-Dyl550 is reactive to CD209 in Human
Reconstitution
Observed Molecular Weight
39 kDa
Calculated molecular weight
45.775kDa
Background of CD209
DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A01025-Dyl550 is guaranteed for Flow Cytometry Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Flow Cytometry (Fixed), 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Boster Kit Box
Protein Target Info & Infographic
Gene/Protein Information For CD209 (Source: Uniprot.org, NCBI)
Gene Name
CD209
Full Name
CD209 antigen
Weight
45.775kDa
Alternative Names
CD209 antigen; C-type lectin domain family 4 member L; Dendritic cell-specific ICAM-3-grabbing non-integrin 1; DC-SIGN; DC-SIGN1; CD209; CD209; CLEC4L CD209 CDSIGN, CLEC4L, DC-SIGN, DC-SIGN1 CD209 molecule CD209 |C-type lectin domain family 4 member L|HIV gpl20-binding protein|dendritic cell-specific ICAM-3-grabbing non-integrin 1|dendritic cell-specific intercellular adhesion molecule-3-grabbing non-integrin|dendritic cell-specific intracellular adhesion molecules (ICAM)-3 grabbing non-integrin
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CD209, check out the CD209 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CD209: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Human DC-SIGN DyLight® 550 conjugated CD209 Antibody (A01025-Dyl550)
Hello CJ!
No publications found for A01025-Dyl550
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Human DC-SIGN DyLight® 550 conjugated CD209 Antibody?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Human DC-SIGN DyLight® 550 conjugated CD209 Antibody
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
14 Customer Q&As for Anti-Human DC-SIGN DyLight® 550 conjugated CD209 Antibody
Question
Do you have a BSA free version of anti-Human DC-SIGN DyLight® 550 conjugated antibody A01025-Dyl550 available?
Verified Customer
Verified customer
Asked: 2020-04-07
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-Human DC-SIGN DyLight® 550 conjugated antibody A01025-Dyl550 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-04-07
Question
I have a question about product A01025-Dyl550, anti-Human DC-SIGN DyLight® 550 conjugated antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-03-30
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01025-Dyl550 anti-Human DC-SIGN DyLight® 550 conjugated antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-03-30
Question
Is a blocking peptide available for product anti-Human DC-SIGN DyLight® 550 conjugated antibody (A01025-Dyl550)?
Verified Customer
Verified customer
Asked: 2019-11-05
Answer
We do provide the blocking peptide for product anti-Human DC-SIGN DyLight® 550 conjugated antibody (A01025-Dyl550). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2019-11-05
Question
See attached the WB image, lot number and protocol we used for adrenal gland using anti-Human DC-SIGN DyLight® 550 conjugated antibody A01025-Dyl550. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2019-10-22
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-10-22
Question
We are currently using anti-Human DC-SIGN DyLight® 550 conjugated antibody A01025-Dyl550 for human tissue, and we are well pleased with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on dog tissues as well?
Verified Customer
Verified customer
Asked: 2019-09-03
Answer
The anti-Human DC-SIGN DyLight® 550 conjugated antibody (A01025-Dyl550) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-09-03
Question
We have seen staining in human adrenal gland. Are there any suggestions? Is anti-Human DC-SIGN DyLight® 550 conjugated antibody supposed to stain adrenal gland positively?
Verified Customer
Verified customer
Asked: 2019-08-09
Answer
According to literature adrenal gland does express CD209. According to Uniprot.org, CD209 is expressed in adrenal gland, placenta, uterus, among other tissues. Regarding which tissues have CD209 expression, here are a few articles citing expression in various tissues:
Placenta, Pubmed ID: 1518869
Uterus, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-08-09
Question
We were well pleased with the WB result of your anti-Human DC-SIGN DyLight® 550 conjugated antibody. However we have observed positive staining in uterus isoform 1: cell membrane using this antibody. Is that expected? Could you tell me where is CD209 supposed to be expressed?
Verified Customer
Verified customer
Asked: 2019-01-30
Answer
Based on literature, uterus does express CD209. Generally CD209 expresses in isoform 1: cell membrane. Regarding which tissues have CD209 expression, here are a few articles citing expression in various tissues:
Placenta, Pubmed ID: 1518869
Uterus, Pubmed ID: 14702039
Boster Scientific Support
Answered: 2019-01-30
Question
I was wanting to use your anti-Human DC-SIGN DyLight® 550 conjugated antibody for Flow Cytometry for human adrenal gland on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human adrenal gland identification?
O. Evans
Verified customer
Asked: 2019-01-02
Answer
You can see on the product datasheet, A01025-Dyl550 anti-Human DC-SIGN DyLight® 550 conjugated antibody has been tested for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human adrenal gland in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-01-02
Question
I see that the anti-Human DC-SIGN DyLight® 550 conjugated antibody A01025-Dyl550 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?
K. Lewis
Verified customer
Asked: 2018-09-13
Answer
You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-09-13
Question
Will A01025-Dyl550 anti-Human DC-SIGN DyLight® 550 conjugated antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
Verified Customer
Verified customer
Asked: 2018-05-31
Answer
As indicated on the product datasheet, A01025-Dyl550 anti-Human DC-SIGN DyLight® 550 conjugated antibody as been tested on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2018-05-31
Question
Is this A01025-Dyl550 anti-Human DC-SIGN DyLight® 550 conjugated antibody reactive to the isotypes of CD209?
Verified Customer
Verified customer
Asked: 2018-05-25
Answer
The immunogen of A01025-Dyl550 anti-Human DC-SIGN DyLight® 550 conjugated antibody is A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-05-25
Question
I am interested in to test anti-Human DC-SIGN DyLight® 550 conjugated antibody A01025-Dyl550 on human adrenal gland for research purposes, then I may be interested in using anti-Human DC-SIGN DyLight® 550 conjugated antibody A01025-Dyl550 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2017-12-29
Answer
The products we sell, including anti-Human DC-SIGN DyLight® 550 conjugated antibody A01025-Dyl550, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-12-29
Question
Will anti-Human DC-SIGN DyLight® 550 conjugated antibody A01025-Dyl550 work for Flow Cytometry with adrenal gland?
K. Anderson
Verified customer
Asked: 2017-08-22
Answer
According to the expression profile of adrenal gland, CD209 is highly expressed in adrenal gland. So, it is likely that anti-Human DC-SIGN DyLight® 550 conjugated antibody A01025-Dyl550 will work for Flow Cytometry with adrenal gland.
Boster Scientific Support
Answered: 2017-08-22
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for adrenal gland using anti-Human DC-SIGN DyLight® 550 conjugated antibody A01025-Dyl550. Let me know if you need anything else.
A. Li
Verified customer
Asked: 2016-08-18
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-08-18
