Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband®

Activin RIIB antibody

Boster Bio Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband® catalog # PB9975. Tested in WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB9975
Size: 100 μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband®

View all Activin RIIB Antibodies

SKU/Catalog Number

PB9975

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband® catalog # PB9975. Tested in WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9975)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human ACVR2B, identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9975 is reactive to ACVR2B in Human, Rat

Reconstitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Observed Molecular Weight

55 kDa

Calculated molecular weight

57724 MW

Background of Activin RIIB

Activin receptor type-2B is a protein that in humans is encoded by the ACVR2B gene. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This ACVR2B gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9975 is guaranteed for WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat

Positive Control

WB: rat skeletal muscle tissue, MCF-7 whole cell

Validation Images & Assay Conditions

Gene/Protein Information For ACVR2B (Source: Uniprot.org, NCBI)

Gene Name

ACVR2B

Full Name

Activin receptor type-2B

Weight

57724 MW

Superfamily

protein kinase superfamily

Alternative Names

Activin receptor type-2B;2.7.11.30;Activin receptor type IIB;ACTR-IIB;ACVR2B; ACVR2B ACTRIIB, ActR-IIB, HTX4 activin A receptor type 2B activin receptor type-2B|activin A receptor, type IIB

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ACVR2B, check out the ACVR2B Infographic

ACVR2B infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ACVR2B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9975

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband®?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband®

Question

Is this PB9975 anti-Activin Receptor Type IIB/ACVR2B antibody reactive to the isotypes of ACVR2B?

Verified Customer

Verified customer

Asked: 2020-01-06

Answer

The immunogen of PB9975 anti-Activin Receptor Type IIB/ACVR2B antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human ACVR2B (431-466aa VVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-01-06

Question

We are currently using anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 for rat tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-12-27

Answer

The anti-Activin Receptor Type IIB/ACVR2B antibody (PB9975) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-12-27

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-Activin Receptor Type IIB/ACVR2B antibody PB9975. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-11-20

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-20

Question

Will anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 work for WB with brain?

Verified Customer

Verified customer

Asked: 2019-10-04

Answer

According to the expression profile of brain, ACVR2B is highly expressed in brain. So, it is likely that anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 will work for WB with brain.

Boster Scientific Support

Answered: 2019-10-04

Question

I see that the anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-07-05

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-07-05

Question

Do you have a BSA free version of anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 available?

M. Dhar

Verified customer

Asked: 2017-11-24

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2017-11-24

Question

I was wanting to use your anti-Activin Receptor Type IIB/ACVR2B antibody for WB for human brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human brain identification?

Verified Customer

Verified customer

Asked: 2017-09-04

Answer

As indicated on the product datasheet, PB9975 anti-Activin Receptor Type IIB/ACVR2B antibody has been validated for WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-09-04

Order DetailsPrice
PB9975

100μg

$370
PB9975-10ug

10μg sample (liquid)

$99
PB9975-Biotin

100 μg Biotin conjugated

$570
PB9975-Cy3

100 μg Cy3 conjugated

$570
PB9975-Dylight488

100 μg Dylight488 conjugated

$570
PB9975-Dylight550

100 μg Dylight550 conjugated

$570
PB9975-Dylight594

100 μg Dylight594 conjugated

$570
PB9975-FITC

100 μg FITC conjugated

$570
PB9975-HRP

100 μg HRP conjugated

$570
PB9975-APC

100 μg APC conjugated

$670
PB9975-PE

100 μg PE conjugated

$670
PB9975-iFluor647

100 μg iFluor647 conjugated

$670
PB9975-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9975
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

No publications found

No publications have been found for this product