Product Info Summary
SKU: | PB9975 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband®
View all Activin RIIB Antibodies
SKU/Catalog Number
PB9975
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband® catalog # PB9975. Tested in WB applications. This antibody reacts with Human, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9975)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ACVR2B, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9975 is reactive to ACVR2B in Human, Rat
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Observed Molecular Weight
55 kDa
Calculated molecular weight
57724 MW
Background of Activin RIIB
Activin receptor type-2B is a protein that in humans is encoded by the ACVR2B gene. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. Type II receptors are considered to be constitutively active kinases. This ACVR2B gene encodes activin A type IIB receptor, which displays a 3- to 4-fold higher affinity for the ligand than activin A type II receptor.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB9975 is guaranteed for WB Boster Guarantee
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Positive Control
WB: rat skeletal muscle tissue, MCF-7 whole cell
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of ACVR2B using anti-ACVR2B antibody (PB9975).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat skeletal muscle tissue lysates,
Lane 2: MCF-7 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ACVR2B antigen affinity purified polyclonal antibody (Catalog # PB9975) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ACVR2B at approximately 55 kDa. The expected band size for ACVR2B is at 58 kDa.
Protein Target Info & Infographic
Gene/Protein Information For ACVR2B (Source: Uniprot.org, NCBI)
Gene Name
ACVR2B
Full Name
Activin receptor type-2B
Weight
57724 MW
Superfamily
protein kinase superfamily
Alternative Names
Activin receptor type-2B;2.7.11.30;Activin receptor type IIB;ACTR-IIB;ACVR2B; ACVR2B ACTRIIB, ActR-IIB, HTX4 activin A receptor type 2B activin receptor type-2B|activin A receptor, type IIB
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ACVR2B, check out the ACVR2B Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ACVR2B: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband® (PB9975)
Hello CJ!
No publications found for PB9975
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband®?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Activin Receptor Type IIB/ACVR2B Antibody Picoband®
Question
Is this PB9975 anti-Activin Receptor Type IIB/ACVR2B antibody reactive to the isotypes of ACVR2B?
Verified Customer
Verified customer
Asked: 2020-01-06
Answer
The immunogen of PB9975 anti-Activin Receptor Type IIB/ACVR2B antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human ACVR2B (431-466aa VVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAE), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-01-06
Question
We are currently using anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 for rat tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on primate tissues as well?
Verified Customer
Verified customer
Asked: 2019-12-27
Answer
The anti-Activin Receptor Type IIB/ACVR2B antibody (PB9975) has not been validated for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-12-27
Question
We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-Activin Receptor Type IIB/ACVR2B antibody PB9975. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-11-20
Answer
Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-11-20
Question
Will anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 work for WB with brain?
Verified Customer
Verified customer
Asked: 2019-10-04
Answer
According to the expression profile of brain, ACVR2B is highly expressed in brain. So, it is likely that anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 will work for WB with brain.
Boster Scientific Support
Answered: 2019-10-04
Question
I see that the anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-07-05
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2019-07-05
Question
Do you have a BSA free version of anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 available?
M. Dhar
Verified customer
Asked: 2017-11-24
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Activin Receptor Type IIB/ACVR2B antibody PB9975 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2017-11-24
Question
I was wanting to use your anti-Activin Receptor Type IIB/ACVR2B antibody for WB for human brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human brain identification?
Verified Customer
Verified customer
Asked: 2017-09-04
Answer
As indicated on the product datasheet, PB9975 anti-Activin Receptor Type IIB/ACVR2B antibody has been validated for WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-09-04